PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 465aa    MW: 49991.4 Da    PI: 5.7765
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026990genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.11.6e-32180237158
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  ldDgy+WrKYGqK vk+s+fpr+YYrCtsagC vkk+vers+edp++v++tYeg+H+h
  DCAR_026990 180 LDDGYRWRKYGQKAVKNSPFPRNYYRCTSAGCGVKKRVERSSEDPTTVVTTYEGTHTH 237
                  59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-33165238IPR003657WRKY domain
SuperFamilySSF1182901.96E-28172238IPR003657WRKY domain
PROSITE profilePS5081132.041175240IPR003657WRKY domain
SMARTSM007742.2E-38180239IPR003657WRKY domain
PfamPF031062.4E-26181237IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEEEKKNQEI LNMSDQNLDP SSSVTPPFSG EEIITPVTYP PPPNIFDMPD IDVEKYDFME  60
MLRTQNYYFP PTTSIFDLLG APSPAIGPPQ PQQLTAAAVG TSSDMPVLTP VTPNNSSSIS  120
SSSNEAVTED QISIKTGEDD EEHKPEQKNK RLISEPRKKK PKKQREPRFA FMTQSDIDNL  180
DDGYRWRKYG QKAVKNSPFP RNYYRCTSAG CGVKKRVERS SEDPTTVVTT YEGTHTHICP  240
VNAPRGSIGM FPDAYSFRGL GAGAGIGGGG LMSSGIGSSF SGGIGSSFSG GIGEGIGGGM  300
SINAGYRVGG IGSRLVEGGG IGGGSNIGNV SGTGSGSGSI SDINSHYAAE QLARYQQRMQ  360
QQQQQQQQQR QPYSLYNSII NPSLPSYNFG ITNAPAATAT TTTTTTSANA AIDSGSFSNR  420
MLQDRHNLLP MTPNQQLTMF RDQGLLQDMV ASSQIQSEKK EDKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-261732401077Probable WRKY transcription factor 4
1wj2_A9e-261732401077Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-32WRKY DNA-binding protein 48